Name :
Il1a (Rat) Recombinant Protein
Biological Activity :
Rat Il1a (P16598, 115 a.a. – 270 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins
Tag :
Protein Accession No. :
P16598
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=24493
Amino Acid Sequence :
MGSSHHHHHHSSGLVPRGSHMGSSAPHSFQNNLRYKLIRIVKQEFIMNDSLNQNIYVDMD_x005f
_x005f
RIHLKAASLNDLQLEVKFDMYAYSSGGDDSKYPVTLKVSNTQLFVSAQGEDKPVLLKEIP_x005f
_x005f
ETPKLITGSETDLIFFWEKINSKNYFTSAAFPELLIATKEQSQVHLARGLPSMIDFQIS
Molecular Weight :
20.2
Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Quality Control Testing :
Storage Buffer :
In PBS pH 7.4 (10% glycerol)
Applications :
Functional Study， SDS-PAGE，
Gene Name :
Il1a
Gene Alias :
IL-1 alpha
Gene Description :
interleukin 1 alpha
Gene Summary :
Other Designations :
interleukin-1 alpha
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
KGF/FGF-7 ProteinAccession
Protein tyrosine phosphatases Recombinant Proteins
Popular categories:
Cathepsin D
Carbonic Anhydrase 9 (CA IX)
