Share this post on:

Name :
LGALS7 (Human) Recombinant Protein

Biological Activity :
Human LGALS7 recombinant protein with polyhistidine tag at the N-terminus expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins

Tag :
Result of activity analysis

Protein Accession No. :

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=3963

Amino Acid Sequence :
SNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF with polyhistidine tag at the Nterminus.

Molecular Weight :

Storage and Stability :
Lyophilized protein should be stored at -20°C. Protein aliquots should be stored at-20°C to -80°C. This product is stable for one year. Avoid repeated freeze/thaw cycles.

Host :
Escherichia coli

Interspecies Antigen Sequence :

Preparation Method :
Escherichia coli expression system

Purification :
Ni-NTA chromatography

Quality Control Testing :
SDS-PAGE Stained with Coomassie Blue. SDS-PAGE analysis of LGALS7 (Human) Recombinant Protein.

Storage Buffer :
Lyophilized from a solution containing 1X PBS, pH 7.4. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.

Applications :
Functional Study, SDS-PAGE,

Gene Name :
LGALS7

Gene Alias :
GAL7, LGALS7A

Gene Description :
lectin, galactoside-binding, soluble, 7

Gene Summary :
The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Differential and in situ hybridization studies indicate that this lectin is specifically expressed in keratinocytes and found mainly in stratified squamous epithelium. A duplicate copy of this gene (GeneID:653499) is found adjacent to, but on the opposite strand on chromosome 19. [provided by RefSeq

Other Designations :
galectin 7|galectin-7

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
PDGF-AA ProteinMolecular Weight
HB-EGF ProteinBiological Activity
Popular categories:
TREM-1/CD354
SARS-CoV-2 S1 Protein

Share this post on:

Author: Interleukin Related