Name :
Il13 (Mouse) Recombinant Protein
Biological Activity :
Mouse Il13 (P20109, 22 a.a. – 131 a.a.) partial recombinant protein with His tag expressed in CHO cells.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins
Tag :
Protein Accession No. :
P20109
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=16163
Amino Acid Sequence :
PVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
Molecular Weight :
14 ~ 30
Storage and Stability :
Store at 4°C for 1 week. For long term storage store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Mammals
Interspecies Antigen Sequence :
Preparation Method :
_x005f
_x005f
Mammalian cell (CHO) expression system_x005f
_x005f
Purification :
Quality Control Testing :
Storage Buffer :
Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Applications :
Functional Study， SDS-PAGE，
Gene Name :
Il13
Gene Alias :
Il-13
Gene Description :
interleukin 13
Gene Summary :
Other Designations :
OTTMUSP00000005816
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-4 Proteinsupplier
MIF ProteinSynonyms
Popular categories:
DDR Family
ADAMTS4
