Name :
Il16 (Mouse) Recombinant Protein
Biological Activity :
Mouse Il16 (O54824) recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins
Tag :
Result of activity analysis
Protein Accession No. :
O54824
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=16170
Amino Acid Sequence :
MHDLNSSTDSAASASAASDISVESKEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTINRIFKGDRTGEMVQPGDEILQLAGTAVQGLTRFEAWNVIKALPDGPVTIVIRRTSLQCKQTTASADS
Molecular Weight :
13.2
Storage and Stability :
Store at -20°C on dry atmosphere.After reconstitution with sterilized water, store at -20°C.Aliquot to avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Quality Control Testing :
1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue Lane 1: non-reducing conditionsLane 2: reducing conditions
Storage Buffer :
Lyophilized 10 mM Na2PO4, pH 7.5.
Applications :
Functional Study, SDS-PAGE,
Gene Name :
Il16
Gene Alias :
KIAA4048, mKIAA4048
Gene Description :
interleukin 16
Gene Summary :
Other Designations :
–
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-22 Proteinmanufacturer
Vitronectin Recombinant Proteins
Popular categories:
CD178/FasL
Ovarian Tumour Domain Family DUBs
